Amyloid β-Peptide (1-40) (human)

Catalog # Availability Size / Price Qty
1191/1
Amyloid β-Peptide (1-40) (human)
1 Image
Description: Amyloid β-protein fragment

Purity: ≥95%

Product Details
Citations (1)
Reviews

Biological Activity

Amyloid β-Peptide (1-40) (human) is a peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data

M.Wt:
4329.86
Formula:
C194H295N53O58S
Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
131438-79-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. A? accumulation causes MVB enlargement and is modelled by dominant negative VPS4A
    K Willén, JR Edgar, T Hasegawa, N Tanaka, CE Futter, GK Gouras
    Mol Neurodegener, 2017;12(1):61.
  2. Beta-amyloid(1-40) effects on behavior and memory.
    Cleary et al.
    Brain Res., 1995;682:69
  3. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield.
    Miguel-Hidalgo and Cacabelos
    Acta Neuropathol., 1998;95:455
  4. β-Amyloid protein induces platelet aggregation and supports platelet adhesion.
    Kowalska and Badellino
    Biochem.Biophys.Res.Commun., 1994;205:1829
  5. Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides.
    Yankner et al.
    Science, 1990;250:279

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Amyloid β-Peptide (1-40) (human)

The citations listed below are publications that use Tocris products. Selected citations for Amyloid β-Peptide (1-40) (human) include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Amyloid β-Peptide (1-40) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-40) (human) and earn rewards!

Have you used Amyloid β-Peptide (1-40) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.