Calcitonin (salmon)

Catalog #: 1159 Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
1159/200U	In Stock	200 ug / $188

Bulk Orders

1 Image

Description: Affects bone formation and resorption

Purity: ≥95%

View All Products for Calcitonin and Related Receptor Agonists

Product Details

Supplemental Products

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Stimulates bone formation by osteoblasts and inhibits bone resorption.

Technical Data

M.Wt:

3431.9

Formula:

C₁₄₅H₂₄₀N₄₄O₄₈S₂

Sequence:

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

(Modifications: Disulfide bridge: 1-7, Pro-32 = C-terminal amide)

Solubility:

Soluble to 1 mg/ml in water

Purity:

≥95%

Storage:

Store at -20°C

CAS No:

47931-85-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Customers also Viewed

R&D Systems Recombinant Proteins and Enzymes

Recombinant Human PDGF-DD Protein

Cat # 1159-SB

Citations (18)

Recombinant Mouse Activin RIIB Fc Chimera Protein Bioactivity

Recombinant Mouse Activin RIIB Fc Chimera Protein, CF

Cat # 3725-RB

(1)

Citations (2)

Human Podocalyxin Antibody

Cat # AF1658

Citations (37)

Human Nestin Alexa Fluor® 750-conjugated Antibody

Cat # IC1259S

Human/Mouse Oct-3/4 APC-conjugated Antibody

Cat # IC1759A

Citations (5)

Mouse BMP-4 Antibody

Cat # MAB5020

(2)

Citations (1)

Recombinant Human Tenascin C Protein, CF

Cat # 3358-TC

(1)

Citations (15)

Recombinant Human Flt-3 Ligand/FLT3L GMP Protein, CF

Cat # BT-FT3L-GMP

Recombinant Human CD40 Ligand/TNFSF5 (HEK293-expressed)

Cat # 6420-CL

(2)

Citations (19)

Human BMP-2/BMP-4 Antibody

Cat # MAB355

(2)

Citations (2)

Human KLF4 Antibody

Cat # AF3640

(1)

Citations (44)

R&D Systems Animal-Free Recombinant Proteins

Recombinant Human/Mouse/Rat Activin A, Animal-Free Protein

Cat # AFL338

Recombinant Human IL-6R alpha Fc Chimera Protein, CF

Cat # 11399-SR

Recombinant Human DcR3/TNFRSF6B Fc Chimera Protein, CF

Cat # 142-DC

Citations (11)

Background References

Pharmacology of receptors for calcitonin gene-related peptide and amylin.
Poyner
TiPS, 1995;16:424
Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors.
van Rossum et al.
Neurosci.Biobehav.Rev., 1997;21:649

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Reconstitution Calculator

Molarity Calculator

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Calcitonin (salmon)

There are currently no reviews for this product. Be the first to review Calcitonin (salmon) and earn rewards!

Have you used Calcitonin (salmon)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.