CART (55-102) (rat)

Catalog # Availability Size / Price Qty
3337/100U
CART (55-102) (rat)
1 Image
Description: Neuromodulatory neuropeptide fragment; satiety factor

Purity: ≥95%

Product Details
Citations (1)
Reviews

Biological Activity

CART (55-102) (rat) is a cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response. Induces anxiety and stress behavior in rodents.

Technical Data

M.Wt:
5259.21
Formula:
C226H367N65O65S7
Sequence:
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

(Modifications: Disulfide bridges: 14-32, 20-40, 34-47)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
209615-79-2

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. CART, a new anorectic peptide.
    Thim et al.
    Int.J.Biochem.Cell Biol., 1998;30:1281
  2. Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold.
    Ludvigsen et al.
    Biochemistry, 2001;40:9082
  3. Cocaine- and amphetamine-regulated transcript peptide produces anxiety-like behavior in rodents.
    Chaki et al.
    Eur.J.Pharmacol., 2003;464:49

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for CART (55-102) (rat)

The citations listed below are publications that use Tocris products. Selected citations for CART (55-102) (rat) include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for CART (55-102) (rat)

There are currently no reviews for this product. Be the first to review CART (55-102) (rat) and earn rewards!

Have you used CART (55-102) (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.