Home / GIP Receptor Agonists / [D-Ala2]-GIP (human)

[D-Ala2]-GIP (human)

Catalog #: 6699
2 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
6699/1
[D-Ala2]-GIP (human)
1 Image
Description: Highly potent GIP agonist

Purity: ≥95%

Product Details
Citations (2)
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.

Technical Data

M.Wt:
4983.58
Formula:
C226H338N60O66S
Sequence:
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

(Modifications: Ala-2 = D-Ala)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
444073-04-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for [D-Ala2]-GIP (human)

The citations listed below are publications that use Tocris products. Selected citations for [D-Ala2]-GIP (human) include:

2 Citations: Showing 1 - 2

  1. A brainstem circuit for nausea suppression.
    Authors: Frank Et al.
    Cell Rep  2022;39:110953
  2. Chronic glucose-dependent insulinotropic polypeptide receptor (GIPR) agonism desensitizes adipocyte GIPR activity mimicking functional GIPR antagonism.
    Authors: Bin Et al.
    Nat Commun  2020;11:4981

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for [D-Ala2]-GIP (human)

There are currently no reviews for this product. Be the first to review [D-Ala2]-GIP (human) and earn rewards!

Have you used [D-Ala2]-GIP (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.