Home / Integrin Receptor Inhibitors / Echistatin, α1 isoform

Echistatin, α1 isoform

Catalog #: 3202
2 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
3202/100U
Echistatin, α1 isoform
1 Image
Description: αVβ3 and glycoprotein IIb/IIIa (integrin αIIbβ3) inhibitor

Purity: ≥95%

Product Details
Citations (2)
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Echistatin, α1 isoform is a potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridges: 2-11, 7-32, 8-37, 20-39)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
154303-05-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Echistatin, α1 isoform

The citations listed below are publications that use Tocris products. Selected citations for Echistatin, α1 isoform include:

2 Citations: Showing 1 - 2

  1. Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation.
    Authors: Lin Et al.
    PLoS One  2013;2013:135608
  2. Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells.
    Authors: Schrader Et al.
    Biomed Res Int  2011;53:1192

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Echistatin, α1 isoform

There are currently no reviews for this product. Be the first to review Echistatin, α1 isoform and earn rewards!

Have you used Echistatin, α1 isoform?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.