Home / GIP Receptor Agonists / GIP (human)

GIP (human)

Catalog #: 2084 Datasheet / COA / SDS
Catalog # Availability Size / Price
2084/1 Contact your distributor for availability.1 mg / Please Inquire
GIP (human)
1 Image
Description: Potent insulinotropic gut hormone; GIP agonist
Alternative Names: Gastric Inhibitory Polypeptide (human)

Purity: ≥95%

Product Details
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

GIP (human) is a potent insulinotropic hormone synthesized by duodenal K-cells. High affinity GIP receptor agonist (EC50 = 0.81 nM) that inhibits gastric acid secretion and stimulates pancreatic insulin release in response to glucose. Also affects lipid metabolism and displays mitogenic and antiapoptotic effects in pancreatic β-cells.

Technical Data

M.Wt:
4983.58
Formula:
C226H338N60O66S
Sequence:
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
100040-31-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Functional expression of the rat pancreatic islet glucose-dependent Insotropic polypeptide receptor: ligand binding and intracellular signaling properties.
    Wheeler et al.
    Endocrinol., 1995;136:4629
  2. Glucose-dependent Insotropic polypeptide is a growth factor for β (INS-1) cells by pleiotropic signaling.
    Trumper et al.
    Mol.Endocrinol., 2001;15:1159
  3. Gastric inhibitory polypeptide: the neglected incretin revisited.
    Meier et al.
    Regul.Peptides, 2002;107:1

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for GIP (human)

There are currently no reviews for this product. Be the first to review GIP (human) and earn rewards!

Have you used GIP (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.