Home / GLP-2 Receptor Peptides / GLP-2 (rat)

GLP-2 (rat)

Catalog #: 2259 Datasheet / COA / SDS

Discontinued Product

2259 has been discontinued.
View all GLP-2 Receptor Peptides products.
GLP-2 (rat)
1 Image
Description: Endogenous hormone; displays intestinotrophic activity
Alternative Names: Glucagon-like peptide 2 (rat)
Product Details
Reviews
Biological Activity Technical Data Additional Information Background Product Datasheets Calculators

Biological Activity

GLP-2 (rat) is an endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

GLP-2 (human) also available.

Technical Data

M.Wt:
3796.17
Formula:
C166H256N44O56S
Sequence:
HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
195262-56-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Additional Information

Other Product-Specific Information:

Background References

  1. Glucagon-like peptide-2: divergent signalling pathways.
    Rocha et al.
    J.Surg.Res., 2004;121:5
  2. Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system.
    Brubaker and Drucker
    Endocrinol., 2004;145:2653
  3. Glucagon-like peptide 2 improves intestinal wound healing through induction of epithelial cell migration in vitro-evidence for a TGF-β-mediated effect.
    Bulut et al.
    Reg.Peptides, 2004;121:137

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for GLP-2 (rat)

There are currently no reviews for this product. Be the first to review GLP-2 (rat) and earn rewards!

Have you used GLP-2 (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.