Human Ubiquitin Antibody

Name: Human Ubiquitin Antibody
Brand: R&D Systems
SKU: A-104
Price: 235 USD

Catalog #: A-104
4 Citations Datasheet / COA / SDS

Product is in the process of being discontinued

Discontinued Product

A-104 has been discontinued.

View all Ubiquitin products.

Detection of Human Ubiquitin by Western Blot.

1 Image

All Ubiquitin Antibodies

Product Details

Citations (4)

FAQs

Reviews

Summary Data Examples Preparation and Storage Reconstitution Calculator Background Product Datasheets Related Research Areas

Human Ubiquitin Antibody Summary

Species Reactivity

Human

Specificity

This antibody detects human Ubiquitin and Ubiquitin+1 in Western blots.

Source

Monoclonal Mouse IgG_2B Clone # 83406

Purification

Protein A or G purified from hybridoma culture supernatant

Immunogen

Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ

Formulation

Supplied as a solution in PBS containing Glycerol and Sodium Azide.

Label

Unconjugated

Applications

Recommended Concentration

Sample

Western Blot

0.1-0.5 µg/mL

See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Western Blot

View Larger

Detection of Human Ubiquitin by Western Blot. Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Reconstitution Calculator

Preparation and Storage

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date.

Background: Ubiquitin

Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast. In mammals, four ubiquitin genes encode for two ubiquitinribosomal fusion proteins and two polyubiquitin proteins. Cleavage of the ubiquitin precursors by deubiquitinating enzymes gives rise to identical ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of ubiquitin to target proteins involves the formation of an isopeptide bond between the Cterminal glycine residue of ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multistep process that requires three enzymes: a ubiquitinactivating (E1) enzyme, a ubiquitinconjugating (E2) enzyme, and a ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, ubiquitin was originally named ATPdependent Proteolysis Factor 1 (APF1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and postendocytic sorting.

References

Entrez Gene IDs

7314 (Human); 298693 (Rat)

Alternate Names

RPS27A; UBA52; UBB ubiquitin B; UBB; UBC; Ubiquitin

Product Datasheets

Product Datasheet

COA

SDS

Product Specific Notices

* Contains <0.1% Sodium Azide, which is not hazardous at this concentration according to GHS classifications. Refer to SDS for additional information and handling instructions.

Related Research Areas

Citations for Human Ubiquitin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

4 Citations: Showing 1 - 4
Filter your results:

Filter by:

Parkin Precipitates on Mitochondria via Aggregation and Autoubiquitination
Authors: Ardah, MT;Radwan, N;Khan, E;Kitada, T;Haque, ME;
International journal of molecular sciences
Species: N/A
Sample Types: Recombinant Protein
Applications: Bioassay
Beneficial Effects of Resveratrol in Mouse Gastrocnemius: A Hint to Muscle Phenotype and Proteolysis
Authors: L Mañas-Garc, C Denhard, J Mateu, X Duran, J Gea, E Barreiro
Cells, 2021-09-15;10(9):.
Species: Mouse
Sample Types: Tissue Homogenates
Applications: Western Blot
Site-specific ubiquitylation and SUMOylation using genetic-code expansion and sortase
Authors: M Fottner, AD Brunner, V Bittl, D Horn-Ghetk, A Jussupow, VRI Kaila, A Bremm, K Lang
Nat. Chem. Biol., 2019-02-15;15(3):276-284.
Species: Human
Sample Types: Recombinant Protein
Applications: Western Blot
Trichostatin A, a histone deacetylase inhibitor suppresses NADPH Oxidase 4-Derived Redox Signalling and Angiogenesis
Authors: Nora Y Hakami
J Cell Mol Med, 2016-06-14;0(0):.
Species: Human
Sample Types: Cell Lysates
Applications: Immunoprecipitation