[Pro3]-GIP (Mouse)

Catalog # Availability Size / Price
5838/1 Contact your distributor for availability.1 mg / Please Inquire
[Pro3]-GIP (Mouse)
1 Image
Description: GIP receptor antagonist

Purity: ≥95%

Product Details
Supplemental Products
Reviews

Biological Activity

[Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50 = 2.6μM). Inhibits GIP-stimulated insulin release from pancreatic β cells in vitro. In ob/ob mice, blocks the effects of GIP on insulin release and plasma glucose levels. Also improves intraperitoneal glucose tolerance, insulin sensitivity, and glucose response to feeding in ob/ob mice.

Technical Data

M.Wt:
4971.62
Formula:
C225H342N62O64S
Sequence:
YAPGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Solubility:
Soluble to 2 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for [Pro3]-GIP (Mouse)

There are currently no reviews for this product. Be the first to review [Pro3]-GIP (Mouse) and earn rewards!

Have you used [Pro3]-GIP (Mouse)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.