Home / Nicotinic (a7) Receptor Antagonists / α-Bungarotoxin

α-Bungarotoxin

Catalog #: 2133
28 Citations Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
2133/1
α-Bungarotoxin
1 Image
Description: Selective α7 nAChR antagonist
Alternative Names: α-Bgtx,α-BuTX

Purity: ≥98%

Product Details
Citations (28)
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

α-Bungarotoxin is a neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). Prevents opening of nicotinic receptor-associated ion channels and is selective for α7 receptors over α3β4 receptors (IC50 values are 1.6 nM and > 3 μM respectively).

Technical Data

M.Wt:
7984.14
Formula:
C338H529N97O105S11
Sequence:
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

(Modifications: Disulfide bridges: 3-23, 16-44, 29-33, 48-59, 60-65)

Solubility:
Soluble in water
Purity:
≥98%
Storage:
Store at -20°C
CAS No:
11032-79-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Canonical and Novel Non-Canonical Cholinergic Agonists Inhibit ATP-Induced Release of Monocytic Interleukin-1? via Different Combinations of Nicotinic Acetylcholine Receptor Subunits ?7, ?9 and ?10
    A Zakrzewicz, K Richter, A Agné, S Wilker, K Siebers, B Fink, G Krasteva-C, M Althaus, W Padberg, AJ Hone, JM McIntosh, V Grau
    Front Cell Neurosci, 2017;11(0):189.
  2. Increasing the Receptor Tyrosine Kinase EphB2 Prevents Amyloid-beta-induced Depletion of Cell Surface Glutamate Receptors by a Mechanism That Requires the PDZ-binding Motif of EphB2 and Neuronal Activity.
    Miyamoto T, Kim D, Knox J, Johnson E, Mucke L
    J Biol Chem, 2016;291(4):1719-34.
  3. Neuronal acetylcholine receptors that bind α-bungarotoxin with high affinity function as ligand-gated ion channels.
    Zhang et al.
    Neuron, 1994;12:167
  4. Unmasking the functions of the chromaffin cell α7 nicotinic receptor by using short pulses of acetylcholine and selective blockers.
    Lopez et al.
    Proc.Natl.Acad.Sci.USA, 1998;95:14184

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for α-Bungarotoxin

The citations listed below are publications that use Tocris products. Selected citations for α-Bungarotoxin include:

28 Citations: Showing 1 - 10

  1. Structure and gating mechanism of the α7 nicotinic acetylcholine receptor.
    Authors: Noviello Et al.
    Cell  2021;184:2121
  2. Direct Effects of Nicotine Exposure on Murine Calvaria and Calvarial Cells.
    Authors: Durham Et al.
    Sci Rep  2019;9:3805
  3. M�ller Glial Cells Participate in Retinal Waves via Glutamate Transporters and AMPA Receptors.
    Authors: Zhang Et al.
    Cell Rep  2019;27:2871
  4. α7 Nicotinic Acetylcholine Receptor Signaling Modulates Ovine Fetal Brain Astrocytes Transcriptome in Response to Endotoxin.
    Authors: Cao Et al.
    Front Immunol  2019;10:1063
  5. Zebrafish Differentially Process Color across Visual Space to Match Natural Scenes.
    Authors: Zimmermann Et al.
    Curr Biol  2018;28:2018
  6. Developmental nicotine exposure affects larval brain size and the adult dopaminergic system of Drosophila melanogaster.
    Authors: Morris Et al.
    BMC Dev Biol  2018;18:13
  7. α7 nicotinic acetylcholine receptor signaling modulates the inflammatory phenotype of fetal brain microglia: first evidence of interference by iron homeostasis.
    Authors: Cortes Et al.
    Sci Rep  2017;7:10645
  8. Increasing the Receptor Tyrosine Kinase EphB2 Prevents Amyloid-β-induced Depletion of Cell Surface Glutamate Receptors by a Mechanism That Requires the PDZ-binding Motif of EphB2 and Neuronal Activity.
    Authors: Miyamoto Et al.
    J Neurosci  2016;291:1719
  9. The influence of allosteric modulators and transmembrane mutations on desensitisation and activation of α7 nicotinic acetylcholine receptors.
    Authors: Chatzidaki Et al.
    PLoS One  2015;97:75
  10. NE is required to promote wakefulness and for hypocretin-induced arousal in zebrafish.
    Authors: Singh Et al.
    Elife  2015;4
  11. Novel aspects of cholinergic regulation of colonic ion transport.
    Authors: Bader and Diener
    J Biol Chem  2015;3:e00139
  12. Selective Gating of Neuronal Activity by Intrinsic Properties in Distinct Motor Rhythms.
    Authors: Li
    Neurotherapeutics  2015;35:9799
  13. Cholinergic control of γ power in the midbrain spatial attention network.
    Authors: Bryant Et al.
    Proc Natl Acad Sci U S A  2015;35:761
  14. Structurally similar allosteric modulators of α7 nicotinic acetylcholine receptors exhibit five distinct pharmacological effects.
    Authors: Gill-Thind Et al.
    J Biol Chem  2015;290:3552
  15. Molecular blueprint of allosteric binding sites in a homologue of the agonist-binding domain of the α7 nicotinic acetylcholine receptor.
    Authors: Spurny Et al.
    Neuropharmacology  2015;112:E2543
  16. Habenular expression of rare missense variants of the β4 nicotinic receptor subunit alters nicotine consumption.
    Authors: Ślimak Et al.
    Front Hum Neurosci  2014;8:12
  17. The α 7 nicotinic receptor agonist PHA-543613 hydrochloride inhibits Porphyromonas gingivalis-induced expression of interleukin-8 by oral keratinocytes.
    Authors: Macpherson Et al.
    J Neurosci  2014;63:557
  18. Optogenetic and pharmacologic dissection of feedforward inhibition in Drosophila motion vision.
    Authors: Mauss Et al.
    J Neurosci  2014;34:2254
  19. Nicotine elicits prolonged calcium signaling along ventral hippocampal axons.
    Authors: Zhong Et al.
    Pharmacol Res Perspect  2013;8:e82719
  20. Nicotine attenuates activation of tissue resident macrophages in the mouse stomach through the β2 nicotinic acetylcholine receptor.
    Authors: Némethova Et al.
    Inflamm Res  2013;8:e79264
  21. Fast silencing reveals a lost role for reciprocal inhibition in locomotion.
    Authors: Moult Et al.
    Neuron  2013;77:129
  22. Acetylcholine and antibodies against the acetylcholine receptor protect neurons and astrocytes against beta-amyloid toxicity.
    Authors: Kamynina Et al.
    Int J Biochem Cell Biol  2013;45:899
  23. Functional interaction between pre-synaptic α6β2-containing nicotinic and adenosine A2A receptors in the control of DA release in the rat striatum.
    Authors: Garção Et al.
    Br J Pharmacol  2013;169:1600
  24. CC4, a dimer of cytisine, is a selective partial agonist at α4β2/α6β2 nAChR with improved selectivity for tobacco smoking cessation.
    Authors: Sala Et al.
    Br J Pharmacol  2013;168:835
  25. CHRNA5 as negative regulator of nicotine signaling in normal and cancer bronchial cells: effects on motility, migration and p63 expression.
    Authors: Krais Et al.
    Carcinogenesis  2011;32:1388
  26. Skeletal muscle IP3R1 receptors amplify physiological and pathological synaptic calcium signals.
    Authors: Zhu Et al.
    J Neurosci  2011;31:15269
  27. Activity-dependent expression of Lmx1b regulates specification of serotonergic neurons modulating swimming behavior.
    Authors: Demarque and Spitzer
    Neuron  2010;67:321
  28. Rosiglitazone inhibits alpha4 nicotinic acetylcholine receptor expression in human lung carcinoma cells through peroxisome proliferator-activated receptor gamma-independent signals.
    Authors: Sun Et al.
    Mol Cancer Ther  2009;8:110

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for α-Bungarotoxin

There are currently no reviews for this product. Be the first to review α-Bungarotoxin and earn rewards!

Have you used α-Bungarotoxin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.