Amylin (rat)

Catalog #: 6030 Datasheet / COA / SDS

Discontinued Product

6030 has been discontinued.
View all Calcitonin and Related Receptor Agonists products.
Amylin (rat)
1 Image
Description: Potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors
Product Details
Reviews

Biological Activity

Amylin (rat) is a potent endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors (pEC50 values are 7.06-9.50 at hCTa, 8.11 at rCTa, 7.73-10.1 at hAMY1a, 9.74 at rAMY1a, 7.92 at hAMY1b, 7.78-9.9 at hAMY2a, 7.94 at hAMY2b, 8.09-10.8 at hAMY3a, 9.97 at rAMY and 8.19 at hAMY3b) receptors. Suppresses insulin-stimulated glucose uptake. Delays gastric emptying and promotes satiety. Active in vivo.

Technical Data

M.Wt:
3920.43
Formula:
C167H272N52O53S2
Sequence:
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

(Modifications: Tyr-37 = C-terminal amide, Disulfide bridge between 2 - 7)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
124447-81-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Amylin (rat)

There are currently no reviews for this product. Be the first to review Amylin (rat) and earn rewards!

Have you used Amylin (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.