Home / Amyloid beta Peptides / Amyloid β-peptide (1-40) (rat)

Amyloid β-peptide (1-40) (rat)

Catalog #: 2424 Datasheet / COA / SDS

Discontinued Product

2424 has been discontinued.
View all Amyloid beta Peptides products.
Amyloid β-peptide (1-40) (rat)
1 Image
Description: Amyloid β-protein fragment
Product Details
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Amyloid β-peptide (1-40) (rat) is a rat form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data

M.Wt:
4233.76
Formula:
C190H291N51O57S
Sequence:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Solubility:
Soluble to 1 mg/ml in 1% Ammonia
Storage:
Desiccate at -20°C
CAS No:
144409-98-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Neurotrophic and neurotoxic effects of amyloid beta protein: reversal by tachykinin neuropeptides.
    Yankner et al.
    Science, 1990;250:279
  2. Beta-amyloid(1-40) effects on behavior and memory.
    Cleary et al.
    Brain Res., 1995;682:69
  3. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield.
    Miguel-Hidalgo and Cacabelos
    Acta Neuropathol., 1998;95:455
  4. β-Amyloid protein induces platelet aggregation and supports platelet adhesion.
    Kowalska and Badellino
    Biochem.Biophys.Res.Comm., 1994;205:1829

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Amyloid β-peptide (1-40) (rat)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (1-40) (rat) and earn rewards!

Have you used Amyloid β-peptide (1-40) (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.