Human Osteocalcin APC-conjugated Antibody Summary
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Applications
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Scientific Data
View Larger
Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
View Larger
Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Reconstitution Calculator
Preparation and Storage
- 12 months from date of receipt, 2 to 8 °C as supplied.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
Product Datasheets
Citations for Human Osteocalcin APC-conjugated Antibody
R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.
3
Citations: Showing 1 - 3
Filter your results:
Filter by:
-
Osteocalcin-expressing neutrophils from skull bone marrow exert immunosuppressive and neuroprotective effects after TBI
Authors: Li, J;Wang, H;Ma, P;Li, T;Ren, J;Zhang, J;Zhou, M;He, Y;Yang, T;He, W;Mi, MT;Liu, YW;Dai, SS;
Cell reports
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry -
Increase in bone metabolic markers and circulating osteoblast-lineage cells after orthognathic surgery
Authors: Y Abe, M Chiba, S Yaklai, RS Pechayco, H Suzuki, T Takahashi
Sci Rep, 2019-12-27;9(1):20106.
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry -
Dysregulation of ossification related microRNAs in circulating osteogenic progenitor cells obtained from patients with aortic stenosis
Authors: K Takahashi, M Satoh, Y Takahashi, T Osaki, T Nasu, M Tamada, H Okabayashi, M Nakamura, Y Morino
Clin Sci, 2016-04-14;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry
FAQs
No product specific FAQs exist for this product, however you may
View all Antibody FAQsReviews for Human Osteocalcin APC-conjugated Antibody
There are currently no reviews for this product. Be the first to review Human Osteocalcin APC-conjugated Antibody and earn rewards!
Have you used Human Osteocalcin APC-conjugated Antibody?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
