Human Osteocalcin PE-conjugated Antibody

Catalog # Availability Size / Price Qty
IC1419P
Detection of Osteocalcin in Differentiated Human Mesemchymal Progenitor Cells by Flow Cytometry.
2 Images
Product Details
Citations (7)
FAQs
Supplemental Products
Reviews

Human Osteocalcin PE-conjugated Antibody Summary

Species Reactivity
Human
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
Monoclonal Mouse IgG1 Clone # 190125
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Formulation
Supplied in a saline solution containing BSA and Sodium Azide.
Label
Phycoerythrin (Excitation= 488 nm, Emission= 565-605 nm)

Applications

Recommended Concentration
Sample
Intracellular Staining by Flow Cytometry
10 µL/106 cells
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Differentiated Human Mesemchymal Progenitor Cells antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Differentiated Human Mesemchymal Progenitor Cells by Flow Cytometry. Differentiated human mesemchymal progenitor cells were stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Saos‑2 Human Cell Line antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin PE-conjugated Monoclonal Antibody (Catalog # IC1419P, filled histogram) or isotype control antibody (Catalog # IC002P, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name
Bone gamma-Carboxyglutamate [gla] Protein
Entrez Gene IDs
632 (Human); 12096 (Mouse); 25295 (Rat)
Alternate Names
BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

You must select a language.

x

Citations for Human Osteocalcin PE-conjugated Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

7 Citations: Showing 1 - 7
Filter your results:

Filter by:

  1. A miR-125/Sirtuin-7 pathway drives the pro-calcific potential of myeloid cells in diabetic vascular disease
    Authors: Saula Vigili de Kreutzenberg, Alessandra Giannella, Giulio Ceolotto, Elisabetta Faggin, Roberta Cappellari, Marta Mazzucato et al.
    Diabetologia
  2. Cumulative Rheumatic Inflammation Modulates the Bone-Vascular Axis and Risk of Coronary Calcification
    Authors: YH Chan, MC Ngai, Y Chen, MZ Wu, YJ Yu, Z Zhen, K Lai, T Cheung, LM Ho, HY Chung, CS Lau, HF Tse, KH Yiu
    J Am Heart Assoc, 2019-06-04;8(11):e011540.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  3. Type 2 diabetes affects bone cells precursors and bone turnover
    Authors: F Sassi, I Buondonno, C Luppi, E Spertino, E Stratta, M Di Stefano, M Ravazzoli, G Isaia, M Trento, P Passera, M Porta, GC Isaia, P D'Amelio
    BMC Endocr Disord, 2018-08-08;18(1):55.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  4. Age, gender, and percentage of circulating osteoprogenitor (COP) cells: The COP Study
    Authors: P Gunawarden, A Al Saedi, L Singh, S Bermeo, S Vogrin, S Phu, P Suriyaarac, RJ Pignolo, G Duque
    Exp. Gerontol., 2017-06-06;96(0):68-72.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  5. NZ-GMP Approved Serum Improve hDPSC Osteogenic Commitment and Increase Angiogenic Factor Expression
    Front Physiol, 2016-08-19;7(0):354.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  6. Bone disease in newly diagnosed lupus nephritis patients.
    Authors: Resende A, dos Reis L, Dias C, Custodio M, Jorgetti V, Woronik V
    PLoS ONE, 2014-09-17;9(9):e106728.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  7. Histone deacetylase inhibition with valproic acid downregulates osteocalcin gene expression in human dental pulp stem cells and osteoblasts: evidence for HDAC2 involvement.
    Authors: Paino F, La Noce M, Tirino V, Naddeo P, Desiderio V, Pirozzi G, De Rosa A, Laino L, Altucci L, Papaccio G
    Stem Cells, 2014-01-01;32(1):279-89.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human Osteocalcin PE-conjugated Antibody

There are currently no reviews for this product. Be the first to review Human Osteocalcin PE-conjugated Antibody and earn rewards!

Have you used Human Osteocalcin PE-conjugated Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review