Human/Rat Osteocalcin Alexa Fluor® 700-conjugated Antibody

Catalog #: IC1419N Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
IC1419N-100UG

1 Image

All Osteocalcin Antibodies

Product Details

Reviews

Summary Data Examples Preparation and Storage Reconstitution Calculator Background Product Datasheets Related Research Areas

Human/Rat Osteocalcin Alexa Fluor® 700-conjugated Antibody Summary

Species Reactivity

Human, Rat

Specificity

Detects human Osteocalcin in direct ELISAs.

Source

Monoclonal Mouse IgG1 Clone # 190125

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Formulation

Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.

Label

Alexa Fluor 700 (Excitation= 675-700 nm, Emission= 723 nm)

Applications

Recommended Concentration

Sample

Intracellular Staining by Flow Cytometry

0.25-1 µg/10⁶ cells

Saos-2 human osteosarcoma cell line and human osteoblasts were fixed with paraformaldehyde and permeabilized with saponin

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Reconstitution Calculator

Preparation and Storage

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store the unopened product at 2 - 8 °C. Do not use past expiration date.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Alternate Names

BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

Product Datasheet

COA

SDS

Product Specific Notices

This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.