Human Ubiquitin/Ubiquitin+1 Antibody

Catalog # Availability Size / Price Qty
MAB701
MAB701-SP
Ubiquitin/Ubiquitin+1 in Human Alzheimer's Disease Brain.
2 Images
Product Details
Citations (2)
FAQs
Supplemental Products
Reviews

Human Ubiquitin/Ubiquitin+1 Antibody Summary

Species Reactivity
Human
Specificity
Detects human Ubiquitin/Ubiquitin+1 in Western blots..
Source
Monoclonal Mouse IgG2B Clone # 83406
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.

Applications

Recommended Concentration
Sample
Western Blot
1-2 µg/mL
See below
Immunohistochemistry
8-25 µg/mL
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Immunohistochemistry Ubiquitin/Ubiquitin+1 antibody in Human Alzheimer's Disease Brain by Immunohistochemistry (IHC-P). View Larger

Ubiquitin/Ubiquitin+1 in Human Alzheimer's Disease Brain. Ubiquitin/Ubiquitin+1 was detected in immersion fixed paraffin-embedded sections of human Alzheimer's disease brain (cortex) using 25 µg/mL Mouse Anti-Human Ubiquitin/ Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter-stained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of neurons in the cortex. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Western Blot Detection of Human Ubiquitin/Ubiquitin+1 antibody by Western Blot. View Larger

Detection of Human Ubiquitin/Ubiquitin+1 by Western Blot. Western blot shows samples of Recombinant Human Ubiquitin (Catalog # 701-UB) (2, 1, and 0.5 ng) and Recombinant Human Ubiquitin+1 (Catalog # 703-UB) (2, 1, and 0.5 ng). PVDF membrane was probed with 1-2 µg/mL Mouse Anti-Human Ubiquitin/Ubiquitin+1 Monoclonal Antibody (Catalog # MAB701) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands for Ubiquitin and Ubiquitin+1 were detected at approximately 11 kDa and 13 kDa, respectively (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 9.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS.
Loading...
Shipping
Lyophilized product is shipped at ambient temperature. Liquid small pack size (-SP) is shipped with polar packs. Upon receipt, store immediately at the temperature recommended below.
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Ubiquitin/Ubiquitin+1

Ubiquitin+1 has a carboxyl terminal amino acid sequence that differs from normal Ubiquitin. The different carboxyl terminal sequence appears to result from a frameshift in the Ubiquitin mRNA. The underlying mechanisms creating the mRNA frameshift are not clearly understood. The occurrence of the frameshift that generates Ubiquitin+1 is much more prevalent in patients with Alzheimers Disease or with Down Syndrome than in control individuals who are not afflicted with the disorders. The monoclonal anti-Ubiquitin+1 (Catalog # MAB703) and rabbit polyclonal anti-Ubiquitin+1 (Catalog # AF703) antibodies were raised against the Ubiquitin+1 carboxyl terminal sequence that differs from normal Ubiquitin and are therefore non-reactive with Ubiquitin. Monoclonal anti-Ubiquitin (Catalog # MAB701) detects both Ubiquitin and Ubiquitin+1 indicating that the epitope recognized by this antibody is contained in the portion of the proteins that are identical.

Long Name
frame shift mutant
Entrez Gene IDs
7314 (Human); 298693 (Rat)
Alternate Names
HEL-S-50; UBB; Ubiquitin/Ubiquitin+1

Product Datasheets

You must select a language.

x

Citations for Human Ubiquitin/Ubiquitin+1 Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

2 Citations: Showing 1 - 2
Filter your results:

Filter by:

  1. Threonine-408 Regulates the Stability of Human Pregnane X Receptor through Its Phosphorylation and the CHIP/Chaperone-Autophagy Pathway
    Authors: Junko Sugatani, Yuji Noguchi, Yoshiki Hattori, Masahiko Yamaguchi, Yasuhiro Yamazaki, Akira Ikari
    Drug Metabolism and Disposition
    Species: Human
    Sample Types: Cell Lysates
    Applications: Western Blot
  2. Ubiquitin as potential cerebrospinal fluid marker of Creutzfeldt-Jakob disease.
    Authors: Steinacker P, Rist W, Swiatek-de-Lange M, Lehnert S, Jesse S, Pabst A, Tumani H, von Arnim CA, Mitrova E, Kretzschmar HA, Lenter M, Wiltfang J, Otto M
    Proteomics, 2010-01-01;10(1):81-9.
    Species: Human
    Sample Types: CSF
    Applications: Western Blot

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human Ubiquitin/Ubiquitin+1 Antibody

There are currently no reviews for this product. Be the first to review Human Ubiquitin/Ubiquitin+1 Antibody and earn rewards!

Have you used Human Ubiquitin/Ubiquitin+1 Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review