Home / Klotho / Klotho-derived peptide 1

Klotho-derived peptide 1

Catalog #: 7830 Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
7830/1
Klotho-derived peptide 1
1 Image
Description: TGF-β receptor 2 (TβR2) binding peptide; disrupts the TGF-β/TβR2 interaction

Purity: ≥95%

Product Details
Reviews
Biological Activity Technical Data Product Datasheets Calculators

Biological Activity

Klotho-derived peptide 1 (KP1) is a peptide that binds to TGF-β receptor 2 (TβR2) (Kd = 1.4 μM). It inhibits TGF-β signaling by blocking TGF-β/TβR2 interaction. In mouse models of renal fibrosis, intravenous injection of KP1 results in its specific accumulation in the injured kidneys. It suppresses TGF-β signaling, repressing fibroblast activation and ameliorates kidney fibrosis in vivo.

Technical Data

M.Wt:
3228.48
Formula:
C149H203N39O43
Sequence:
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Klotho-derived peptide 1

There are currently no reviews for this product. Be the first to review Klotho-derived peptide 1 and earn rewards!

Have you used Klotho-derived peptide 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.