Mambalgin 1

Catalog #: 5938 Datasheet / COA / SDS

Discontinued Product

5938 has been discontinued.
View all Acid-sensing Ion Channel Blockers products.
Mambalgin 1
1 Image
Description: Selective ASIC1a inhibitor; analgesic
Product Details
Reviews

Biological Activity

Mambalgin 1 is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Binds to closed/inactive channel. Selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Increases latency of withdrawal response in mouse tail-flick and paw-flick tests. Analgesic.

Technical Data

M.Wt:
6554.51
Formula:
C272H429N85O84S10
Sequence:
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK

(Modifications: Disulfide bridge: 3-19, 12-37, 41-49, 50-55)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
1609937-15-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Black mamba venom peptides target acid-sensing ion channels to abolish pain.
    Diochot et al.
    Nature, 2012;490:552

Product Datasheets

Reconstitution Calculator
Molarity Calculator

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Mambalgin 1

There are currently no reviews for this product. Be the first to review Mambalgin 1 and earn rewards!

Have you used Mambalgin 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.