Pramlintide

Catalog # Availability Size / Price Qty
5031/500U
Pramlintide
1 Image
Description: Synthetic version of amylin (Cat. No. 3418)

Purity: ≥95%

Product Details
Citations (1)
Supplemental Products
Reviews

Biological Activity

Pramlintide is a synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data

M.Wt:
3949.42
Formula:
C171H267N51O53S2
Sequence:
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY

(Modifications: Tyr-37 = C-terminal amide, Disulfide bridge: 2-7)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
151126-32-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk.
    Hoogwerf et al.
    Vasc.Health Risk Manag., 2008;4:355
  2. Preclinical pharmacology of pramli. in the rat: comparisons with human and rat amylin.
    Young et al.
    Drug Dev.Res., 1996;37:231
  3. Pramlintide, an antidiabetic, is antineoplastic in colorectal cancer and synergizes with conventional chemotherapy
    MS Al-Keilani, DH Alsmadi, RS Darweesh, KH Alzoubi
    Clin Pharmacol, 2018;10(0):23-29.

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Citation for Pramlintide

The citations listed below are publications that use Tocris products. Selected citations for Pramlintide include:

1 Citation: Showing 1 - 1

  1. Area Postrema Cell Types that Mediate Nausea-Associated Behaviors.
    Authors: Stephen D Et al.
    Neuron  2021;109:461-472.e5

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Pramlintide

There are currently no reviews for this product. Be the first to review Pramlintide and earn rewards!

Have you used Pramlintide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.