Psalmotoxin 1

Catalog # Availability Size / Price Qty
5042/100U In Stock100 ug / $335
Bulk Orders
Psalmotoxin 1
1 Image
Description: Potent and selective ASIC1a channel blocker
Alternative Names: PcTx1

Purity: ≥95%

Product Details
Citations (2)
Reviews

Biological Activity

Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM). Displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and KV2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.

Technical Data

M.Wt:
4689.41
Formula:
C200H312N62O57S6
Sequence:
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT

(Modifications: Disulfide bridges: 3-18, 10-23, 17-33)

Solubility:
Soluble to 2 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
316808-68-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator

Citations for Psalmotoxin 1

The citations listed below are publications that use Tocris products. Selected citations for Psalmotoxin 1 include:

2 Citations: Showing 1 - 2

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Psalmotoxin 1

There are currently no reviews for this product. Be the first to review Psalmotoxin 1 and earn rewards!

Have you used Psalmotoxin 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.