Thymosin β4
Description: Potent actin polymerization regulator
Biological Activity
Thymosin β4 is a naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.Technical Data
M.Wt:
4963.49
Formula:
C212H350N56O78S
Sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
(Modifications: Ser-1 = N-terminal Ac)
Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
77591-33-4
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Thymosin β10 and thymosin β4 are both actin monomer sequestering proteins.
Yu et al.
J.Biol.Chem., 1993;268:502 -
β-thymosins, small acidic peptides with multiple functions.
Huff et al.
Int.J.Biochem.Cell Biol., 2001;33:205 -
Thymosin β4 and angiogenesis: modes of action and therapeutic potential.
Smart et al.
Angiogenesis, 2007;10:229
Product Datasheets
Or select another batch:
View Batch
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for Thymosin β4
There are currently no reviews for this product. Be the first to review Thymosin β4 and earn rewards!
Have you used Thymosin β4?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.
